<html>
<head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0" />
<base href="https://wiki.asterisk.org/wiki" />
<title>Message Title</title>
<style type="text/css">@media only screen and (max-device-width: 480px) {.mobile-only {
width: auto !important;
height: auto !important;
overflow: visible !important;
line-height: normal !important;
font-size: inherit !important;
mso-hide: all;
}
.desktop-only {
display: none !important;
}
/* iPhone 3GS fix for unwanted 20px right margin */
body { min-width: 100% !important; padding: 0; margin: 0; }
#center-content-table { max-width: none; !important; }
#header-pattern-container { padding: 10px 10px 10px 10px !important; line-height: 20px !important; }
#header-avatar-image-container { padding-right: 8px !important; }
#email-content-container { padding: 0 !important; }
.mobile-expand { border-radius: 0 !important; border-left: 0 !important; border-right: 0 !important; padding-left: 26px !important;}
.mobile-resize-text { font-size: 16px !important; line-height: 22px !important; }
#page-title-pattern-header { font-size: 20px !important; line-height: 28px !important; }
#page-title-pattern-icon-image-container-cell { padding-top: 7px !important; }
#inline-user-pattern { display: block !important; }
#inline-user-pattern-avatar { padding-top: 3px !important; }
.contextual-area-pattern { border-bottom: 1px solid #ccc !important; padding: 15px 10px 0 10px !important;}
.users-involved-pattern-column-table { width: 100% !important; }
.users-involved-pattern-avatar-table-cell { padding: 3px 5px 5px 0 !important; }
.users-involved-pattern-column-container { padding-right: 0 !important; }
.contextual-excerpt-pattern, #users-involved-pattern { border: 0 !important; }
/** Aui Typography upsized for mobile **/
#content-excerpt-pattern-container, #contextual-excerpt-pattern-text-container { font-size: 16px !important; line-height: 22px !important; }
#content-excerpt-pattern-container h1, #contextual-excerpt-pattern-text-container h1 { font-size: 24px !important; line-height: 28px !important; }
#content-excerpt-pattern-container h2, #contextual-excerpt-pattern-text-container h2 { font-size: 20px !important; line-height: 28px !important; }
#content-excerpt-pattern-container h3, #contextual-excerpt-pattern-text-container h3 { font-size: 18px !important; line-height: 24px !important; }
#content-excerpt-pattern-container h4, #contextual-excerpt-pattern-text-container h4 { font-size: 16px !important; line-height: 22px !important; }
#content-excerpt-pattern-container h5, #contextual-excerpt-pattern-text-container h5 { font-size: 14px !important; line-height: 20px !important; }
#content-excerpt-pattern-container h6, #contextual-excerpt-pattern-text-container h6 { font-size: 14px !important; line-height: 20px !important; }
.user-mention { line-height: 18px !important; }
/** Aui Typography end **/
/* Show appropriate footer logo on mobile, display links vertically */
#footer-pattern { padding: 15px 10px !important; }
#footer-pattern-logo-desktop-container { padding: 0 !important; }
#footer-pattern-logo-desktop { width: 0 !important; height: 0 !important; }
#footer-pattern-logo-mobile {
padding-top: 10px !important;
width: 30px !important;
height: 27px !important;
display: inline !important;
}
#footer-pattern-text {
display: block !important;
}
#footer-pattern-links-container { line-height: 0 !important;}
.footer-pattern-links.mobile-resize-text,
.footer-pattern-links.mobile-resize-text,
#footer-pattern-text.mobile-resize-text,
#footer-pattern-links-container.no-footer-links {
font-size: 14px !important;
line-height: 20px !important;
}
.footer-link { display: block !important; }
#footer-pattern-links-container table { display: inline-block !important; float: none !important; }
#footer-pattern-links-container, #footer-pattern-text { text-align: center !important; }
#footer-pattern-links { padding-bottom: 5px !important; }
/** Team Calendar overrides, these should be removed when notifications are updated in Team Calendars. For now CSS
overrides are being used because the structure of the content can't change without rereleasing the plugin */
.mail-calendar-container .day-header + table tr td:first-child {
vertical-align: top !important;
padding-top: 5px !important;
}}
@media (min-width: 900px) {#center-content-table { width: 900px; }}
@media all {#outlook a {padding:0;} /* Force Outlook to provide a "view in browser" menu link. */
/* Prevent Webkit and Windows Mobile platforms from changing default font sizes.*/
body{-webkit-text-size-adjust:100%; -ms-text-size-adjust:100%;}
.ExternalClass {width:100%;} /* Force Hotmail to display emails at full width */
#background-table {margin:0; padding:0; width:100% !important; }
/* Needed to override highlighting on date and time links in iOS */
.grey a {color: #707070; text-decoration: none; }/* These styles are appended to the head element of a notification in order to prevent Apple Mail and similar
clients from underlining the due dates with a blue hyperlink */
/* a lozenge outside an inline task should always be #333, lozenges inside an inline task should be
colored according to their upcoming due dates, a completed task date lozenge or deleted task date
lozenge should always be #707070 */
.date-time-lozenge a {color: #333333; text-decoration: none; }
.inline-task-text-container .date-time-lozenge.date-upcoming a {color: #DF6F00; text-decoration: none; }
.inline-task-text-container .date-time-lozenge.date-past a {color: #D04437; text-decoration: none; }
.inline-task-text-container.content-deleted-color .date-time-lozenge a,
.inline-task-text-container.checked .date-time-lozenge a {
color: #707070; text-decoration: none;
}}
</style>
</head>
<body>
<table id="background-table" cellpadding="0" cellspacing="0" width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; background-color: #f5f5f5">
<tbody>
<tr>
<td id="header-pattern-container" style="padding: 0px; border-collapse: collapse; padding: 10px 20px">
<table id="header-pattern" cellspacing="0" cellpadding="0" border="0" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td id="header-avatar-image-container" valign="top" style="padding: 0px; border-collapse: collapse; vertical-align: top; width: 32px; padding-right: 9px"><a href="https://wiki.asterisk.org/wiki/display/~rnewton?src=email" style="color: #3b73af; text-decoration: none"><img id="header-avatar-image" class="image_fix" src="cid:avatar_925838d3d8b1f71935f30b314c925d64" height="32" width="32" border="0" style="border-radius: 3px; vertical-align: top" /></a></td>
<td id="header-text-container" valign="middle" style="padding: 0px; border-collapse: collapse; vertical-align: middle; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 1px">Rusty Newton <strong>edited</strong> a page</td>
</tr>
</tbody>
</table> </td>
</tr>
<!-- End Header pattern -->
<tr>
<td id="email-content-container" style="padding: 0px; border-collapse: collapse; padding: 0 20px">
<table id="email-content-table" cellspacing="0" cellpadding="0" border="0" width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; border-spacing: 0; border-collapse: separate">
<tbody>
<tr>
<td class="email-content-rounded-top mobile-expand" style="padding: 0px; border-collapse: collapse; color: #fff; padding: 0 15px 0 16px; height: 15px; background-color: #fff; border-left: 1px solid #ccc; border-top: 1px solid #ccc; border-right: 1px solid #ccc; border-bottom: 0; border-top-right-radius: 5px; border-top-left-radius: 5px"> </td>
</tr>
<tr>
<td class="email-content-main mobile-expand" style="padding: 0px; border-collapse: collapse; border-left: 1px solid #ccc; border-right: 1px solid #ccc; border-top: 0; border-bottom: 0; padding: 0 15px 15px 16px; background-color: #fff">
<table class="notification-comment-pattern" cellspacing="0" cellpadding="0" border="0" width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 2px">
<tbody>
<tr>
<td class="notification-comment-pattern-container mobile-resize-text" style="padding: 0px; border-collapse: collapse; padding: 0px"><strong>Change comment:</strong> More detail!</td>
</tr>
</tbody>
</table> </td>
</tr>
<tr>
<td class="email-content-main mobile-expand padding-top border-top" style="padding: 0px; border-collapse: collapse; border-left: 1px solid #ccc; border-right: 1px solid #ccc; border-top: 0; border-bottom: 0; padding: 0 15px 15px 16px; background-color: #fff; border-top: 1px solid #ccc; padding-top: 15px">
<table id="page-title-pattern" cellspacing="0" cellpadding="0" border="0" width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td id="page-title-pattern-icon-image-container" valign="top" style="padding: 0px; border-collapse: collapse; width: 16px; vertical-align: top">
<table cellspacing="0" cellpadding="0" border="0" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td id="page-title-pattern-icon-image-container-cell" style="padding: 0px; border-collapse: collapse; width: 16px; padding: 9px 8px 0px 0px; mso-text-raise: 5px; mso-line-height-rule: exactly"><a href="https://wiki.asterisk.org/wiki/display/AST/Feature+Code+Call+Transfers?src=email" title="page icon" style="vertical-align: top;; color: #3b73af; text-decoration: none"><img style="vertical-align: top; display: block;" src="cid:page-icon" alt="page icon" title="page icon" height="16" width="16" border="0" /></a></td>
</tr>
</tbody>
</table> </td>
<td style="vertical-align: top;; padding: 0px; border-collapse: collapse; padding-right: 5px; font-size: 20px; line-height: 30px; mso-line-height-rule: exactly" id="page-title-pattern-header-container"><span id="page-title-pattern-header" style="font-family: Arial, sans-serif; padding: 0; font-size: 20px; line-height: 30px; mso-text-raise: 2px; mso-line-height-rule: exactly; vertical-align: middle"><a href="https://wiki.asterisk.org/wiki/display/AST/Feature+Code+Call+Transfers?src=email" title="Feature Code Call Transfers" style="color: #3b73af; text-decoration: none">Feature Code Call Transfers</a></span></td>
</tr>
</tbody>
</table> </td>
</tr>
<tr>
<td class="email-content-main mobile-expand" style="padding: 0px; border-collapse: collapse; border-left: 1px solid #ccc; border-right: 1px solid #ccc; border-top: 0; border-bottom: 0; padding: 0 15px 15px 16px; background-color: #fff">
<table class="content-excerpt-pattern" cellspacing="0" cellpadding="0" border="0" width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 1px">
<tbody>
<tr>
<td class="content-excerpt-pattern-container mobile-resize-text " style="padding: 0px; border-collapse: collapse; padding: 0 0 0 24px">
<div class="contentLayout2 diff-block-target">
<table width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr class="columnLayout two-equal" data-layout="two-equal">
<td valign="top" class="cell normal" data-type="normal" style="padding: 0px; border-collapse: collapse">
<div class="innerCell">
<table class="diff-macro" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/warning.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Warning</th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <p style="margin: 10px 0 0 0; margin-top: 0">Under Construction</p> </td>
</tr>
</tbody>
</table>
<h1 id="FeatureCodeCallTransfers-OverviewofFeatureCodeCallTransfers" style="margin: 10px 0 0 0; font-size: 24px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0">Overview of Feature Code Call Transfers</h1>
<p style="margin: 10px 0 0 0">A call transfer is when one party of a call directs Asterisk to connect the other party to a new location on the system.</p>
<p style="margin: 10px 0 0 0">Transfer types supported by the Asterisk core:</p>
<ul style="margin: 10px 0 0 0">
<li>Blind transfer</li>
<li>Attended transfer
<ul style="margin: 10px 0 0 0; margin-top: 0">
<li>Variations on attended transfer behavior</li>
</ul> </li>
</ul>
<p style="margin: 10px 0 0 0">Transfer features provided by the Asterisk core are configured in features.conf and accessed with feature codes.</p>
<p style="margin: 10px 0 0 0">Channel driver technologies such as chan_sip and chan_pjsip have native capability for various transfer types. That native transfer functionality is independent of this core transfer functionality. The core feature code transfer functionality is channel agnostic.</p>
</div> </td>
<td valign="top" class="cell normal" data-type="normal" style="padding: 0px; border-collapse: collapse">
<div class="innerCell">
<table class="diff-macro diff-html-added" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;background-color: #ddfade;border-color: #93c49f;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="diff-html-added" id="added-diff-0" style="font-size: 100%; background-color: #ddfade;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/panel.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Panel</span></th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-properties" style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;padding: 0; border: 1px solid #dddddd;; padding: 0px; border-collapse: collapse">
<table style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">title</span></td>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">On this Page</span></td>
</tr>
</tbody>
</table> </td>
</tr>
</tbody>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <p style="margin: 10px 0 0 0; margin-top: 0"></p>
<table class="diff-macro bodyless diff-html-added" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;margin: 5px 0; padding: 0; width: auto;background-color: #ddfade;border-color: #93c49f;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/toc.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Table of Contents</span></th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-properties" style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;padding: 0; border: 1px solid #dddddd;; padding: 0px; border-collapse: collapse">
<table style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">maxLevel</span></td>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">2</span></td>
</tr>
</tbody>
</table> </td>
</tr>
</tbody>
</table> <p style="margin: 10px 0 0 0"></p> </td>
</tr>
</tbody>
</table>
</div> </td>
</tr>
</tbody>
</table>
<table width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr class="columnLayout single" data-layout="single">
<td valign="top" class="cell normal" data-type="normal" style="padding: 0px; border-collapse: collapse">
<div class="innerCell">
<h2 id="FeatureCodeCallTransfers-Blindtransfer" style="margin: 10px 0 0 0; margin-top: 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0; margin-top: 0"> <span class="diff-html-changed" id="changed-diff-0" style="background-color: #d6f0ff;">Blind transfer</span> </h2>
<p style="margin: 10px 0 0 0"> <span class="diff-html-changed" style="background-color: #d6f0ff;">A blind or unsupervised transfer is where the initiating party is blind to what is happening after initiating the transfer. They are removed from the process as soon as they initiate the transfer. It is a sort of "fire and forget" transfer.</span> </p>
<h2 id="FeatureCodeCallTransfers-Attendedtransfer" style="margin: 10px 0 0 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0"> <span class="diff-html-changed" style="background-color: #d6f0ff;">Attended transfer</span> </h2>
<p style="margin: 10px 0 0 0"> <span class="diff-html-changed" style="background-color: #d6f0ff;">An attended or supervised transfer happens when one party transfers another party to a new location by first dialing the transfer destination and only completing the transfer when ready. The initiating party is attending or supervising the transfer process by contacting the destination before completing the transfer. This is helpful if the transfer initiator wants to make sure someone answers or is ready at the destination.</span> </p>
</div> </td>
</tr>
</tbody>
</table>
<p style="margin: 10px 0 0 0"> <span class="diff-html-removed" id="removed-diff-0" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;"> </span> </p>
</div></td>
<td valign="top" class="cell normal" data-type="normal" style="padding: 0px; border-collapse: collapse">
<div class="innerCell">
<table class="diff-macro diff-html-removed" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;background-color: #ffe7e7;border-color: #df9898;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/panel.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Panel</span></th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-properties" style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;padding: 0; border: 1px solid #dddddd;; padding: 0px; border-collapse: collapse">
<table style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">title</span></td>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">On this Page</span></td>
</tr>
</tbody>
</table> </td>
</tr>
</tbody>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <p style="margin: 10px 0 0 0; margin-top: 0"></p>
<table class="diff-macro bodyless diff-html-removed" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;margin: 5px 0; padding: 0; width: auto;background-color: #ffe7e7;border-color: #df9898;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/toc.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Table of Contents</span></th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-properties" style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;padding: 0; border: 1px solid #dddddd;; padding: 0px; border-collapse: collapse">
<table style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">maxLevel</span></td>
<td style="background-color: #fafafa; padding: 0 0 0 5px; font-size: 12px; text-align: left;; padding: 0px; border-collapse: collapse"><span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">2</span></td>
</tr>
</tbody>
</table> </td>
</tr>
</tbody>
</table> <p style="margin: 10px 0 0 0"></p> </td>
</tr>
</tbody>
</table>
</div> </td>
</tr>
</tbody>
</table>
<table width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr class="columnLayout single" data-layout="single">
<td valign="top" class="cell normal" data-type="normal" style="padding: 0px; border-collapse: collapse">
<div class="innerCell">
<h1 id="FeatureCodeCallTransfers-ConfiguringTransferFeatures" style="margin: 10px 0 0 0; margin-top: 0; font-size: 24px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0; margin-top: 0">Configuring Transfer Features</h1>
<p style="margin: 10px 0 0 0">There are three primary requirements for the use of core transfer functionality.</p>
<ul style="margin: 10px 0 0 0">
<li>The transfer type must be enabled and assigned a DTMF digit string in features.conf or per channel - see (((Dynamic DTMF Features)))</li>
<li>The channel must allow the type of transfer attempted. This can be configured via the Application invoking the channel such as Dial or Queue.</li>
<li>The channels involved must be answered and bridged.</li>
</ul>
<h2 id="FeatureCodeCallTransfers-Enablingblindorattendedtransfers" style="margin: 10px 0 0 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0">Enabling blind or attended transfers</h2>
<p style="margin: 10px 0 0 0">In features.conf you must configure the blindxfer or atxfer options in the featuremap section. The options are configured with the DTMF character string you want to use for accessing the feature.</p>
<table class="diff-macro" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/plugins/servlet/confluence/placeholder/macro-icon?name=code" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Code Block</th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <pre style="margin: 10px 0 0 0; margin-top: 0">[featuremap]
blindxfer =<span class="diff-html-removed" id="removed-diff-1" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">></span> #1
atxfer =<span class="diff-html-removed" id="removed-diff-2" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">></span> *2</pre> </td>
</tr>
</tbody>
</table>
<p style="margin: 10px 0 0 0">Now that you have the feature enabled you need to configure the dialplan such that a particular channel will be allowed to use the feature.</p>
<p style="margin: 10px 0 0 0">As an example if you want to allow transfers via the <a class="confluence-link unresolved" href="#" style="color: #3b73af; text-decoration: none">Dial</a> application you can use two options, "t" or "T".</p>
<ul style="margin: 10px 0 0 0">
<li>t - Allow the called party to transfer the calling party by sending the DTMF sequence defined in features.conf. This setting does not perform policy enforcement on transfers initiated by other methods</li>
<li>T - Allow the calling party to transfer the called party by sending the DTMF sequence defined in features.conf. This setting does not perform policy enforcement on transfers initiated by other methods.</li>
</ul>
<p style="margin: 10px 0 0 0">Setting these options for Dial in extensions.conf would look similar to the following:</p>
<table class="diff-macro" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/plugins/servlet/confluence/placeholder/macro-icon?name=code" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Code Block</th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <pre style="margin: 10px 0 0 0; margin-top: 0">exten = 102,1,Dial(PJSIP/BOB,30,T)</pre> </td>
</tr>
</tbody>
</table>
<p style="margin: 10px 0 0 0">Asterisk should be restarted or relevant modules should be reloaded for changes to take effect.</p>
<table class="diff-macro" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/tip.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Tip</th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <p style="margin: 10px 0 0 0; margin-top: 0">The same arguments ("t" and "T") work for the <a class="confluence-link unresolved" href="#" style="color: #3b73af; text-decoration: none">Queue</a> and <a class="confluence-link unresolved" href="#" style="color: #3b73af; text-decoration: none">Dial</a> applications!</p> </td>
</tr>
</tbody>
</table>
<h1 id="FeatureCodeCallTransfers-EnablingAttendedTransferVariations" style="margin: 10px 0 0 0; font-size: 24px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0"> <span class="diff-html-removed" id="removed-diff-3" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">Enabling Attended Transfer Variations</span> </h1>
<p style="margin: 10px 0 0 0"> <span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">Stuff to be formatted here.</span> </p>
<h1 id="FeatureCodeCallTransfers-ExampleUsage" style="margin: 10px 0 0 0; font-size: 24px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0"> <span class="diff-html-removed" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">Example Usage</span> </h1>
<h2 id="FeatureCodeCallTransfers-Otherattendedtransferfeaturecodes" style="margin: 10px 0 0 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0; margin-top: 10px"> <span class="diff-html-added" id="added-diff-1" style="font-size: 100%; background-color: #ddfade;">Other attended transfer feature codes</span> </h2>
<p style="margin: 10px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">There are a few additional feature codes related to attended transfers. These features allow you to vary the behavior of an attended transfer on command. They are all configured in the 'general' section of features.conf</span> </p>
<table class="diff-macro diff-html-added" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;background-color: #ddfade;border-color: #93c49f;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/plugins/servlet/confluence/placeholder/macro-icon?name=code" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>Code Block</span></th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <pre style="margin: 10px 0 0 0; margin-top: 0">
<span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">[general]
atxferabort = *3
atxfercomplete = *4
atxferthreeway = *5
atxferswap = *6</span>
</pre> </td>
</tr>
</tbody>
</table>
<h3 id="FeatureCodeCallTransfers-Abortinganattendedtransfer" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Aborting an attended transfer</span> </h3>
<p style="margin: 10px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Dialing the </span><strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">atxferabort</span></strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;"> code aborts an attended transfer. Otherwise there is no way to abort an attended transfer.</span> </p>
<h3 id="FeatureCodeCallTransfers-Completinganattendedtransfer" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Completing an attended transfer</span> </h3>
<p style="margin: 10px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Dialing the </span><strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">atxfercomplete</span></strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;"> code completes an attended transfer and drops out of the call without having to hang up.</span> </p>
<h3 id="FeatureCodeCallTransfers-Completinganattendedtransferasathree-waybridge" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Completing an attended transfer as a three-way bridge</span> </h3>
<p style="margin: 10px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Dialing the </span><strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">atxferthreeway</span></strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;"> code completes an attended transfer and enters a bridge with both of the other parties.</span> </p>
<h3 id="FeatureCodeCallTransfers-Swappingbetweenthetransfereeanddestination" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Swapping between the transferee and destination</span> </h3>
<p style="margin: 10px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Dialing the </span><strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">atxferswap</span></strong><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;"> code swaps you between bridges with either party before the transfer is complete. This allows you to talk to either party one at a time before finalizing the attended transfer.</span> </p>
<h2 id="FeatureCodeCallTransfers-Attendedtransfercallbacks" style="margin: 10px 0 0 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Attended transfer callbacks</span> </h2>
<p style="margin: 10px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">By default Asterisk will call back the initiator of the transfer if they hang up before the target answers and the answer timeout is reached. There are a few options for configuring this behavior.</span> </p>
<table class="diff-macro diff-html-added" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;background-color: #ddfade;border-color: #93c49f;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/noformat.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>No Format</span></th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <pre style="margin: 10px 0 0 0; margin-top: 0">
<span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">;atxfernoanswertimeout = 15 ; Timeout for answer on attended transfer default is 15 seconds.
;atxferdropcall = no ; If someone does an attended transfer, then hangs up before the transfer
; target answers, then by default, the system will try to call back the
; person that did the transfer. If this is set to "yes", the ringing
; transfer target is immediately transferred to the transferee.
;atxferloopdelay = 10 ; Number of seconds to sleep between retries (if atxferdropcall = no)
;atxfercallbackretries = 2 ; Number of times to attempt to send the call back to the transferer.
; By default, this is 2.</span>
</pre> </td>
</tr>
</tbody>
</table>
<h3 id="FeatureCodeCallTransfers-Noanswertimeout" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">No answer timeout</span> </h3>
<h3 id="FeatureCodeCallTransfers-Droppedcallbehavior" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Dropped call behavior</span> </h3>
<h3 id="FeatureCodeCallTransfers-Loopdelaytiming" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Loop delay timing</span> </h3>
<h3 id="FeatureCodeCallTransfers-Numberofretriesforcallbacks" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Number of retries for callbacks</span> </h3>
<h1 id="FeatureCodeCallTransfers-BasicTransferExamples" style="margin: 10px 0 0 0; font-size: 24px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0"> <span class="diff-html-added" style="font-size: 100%; background-color: #ddfade;">Basic Transfer Examples</span> </h1>
<p style="margin: 10px 0 0 0">In the previous section we configured #1 and *2 as our features codes. We also passed the "T" argument in the Dial application at 102 to allow transfers by the calling party.</p>
<p style="margin: 10px 0 0 0">Our hypothetical example includes a few devices:</p>
<ul style="margin: 10px 0 0 0">
<li>PJSIP/ALICE at extension 101</li>
<li>PJSIP/BOB at extension 102</li>
<li>PJSIP/CATHY at extension 103</li>
</ul>
<h2 id="FeatureCodeCallTransfers-Makingablindtransfer" style="margin: 10px 0 0 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0">Making a blind transfer</h2>
<p style="margin: 10px 0 0 0">For blind transfers we configured the #1 feature code.</p>
<p style="margin: 10px 0 0 0">An example call flow:</p>
<ul style="margin: 10px 0 0 0">
<li>ALICE dials extension 102 to call BOB</li>
<li>ALICE decides to transfer BOB to extension 103, so she dials #1. Asterisk will play the audio prompt "transfer".</li>
<li>ALICE enters the digits 103 for the destination extension.</li>
<li>Asterisk immediately hangs up the channel between ALICE and BOB. Asterisk creates a new channel for BOB that is dialing extension 103.</li>
</ul>
<h2 id="FeatureCodeCallTransfers-Makinganattendedtransfer" style="margin: 10px 0 0 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0">Making an attended transfer</h2>
<p style="margin: 10px 0 0 0">For attended transfers we configured *2 as our feature code.</p>
<p style="margin: 10px 0 0 0">An example call flow:</p>
<ul style="margin: 10px 0 0 0">
<li>ALICE dials extension 102 to call BOB and BOB answers.</li>
<li>ALICE decides to transfer BOB to extension 103, so she dials *2. Asterisk plays the audio prompt "transfer".</li>
<li>ALICE enters the digits 103 for the destination extension. Asterisk places BOB on hold and creates a channel for ALICE to dial CATHY.</li>
<li>CATHY answers - ALICE and CATHY talk. ALICE decides to complete the transfer and hangs up the phone.</li>
<li>Asterisk immediately hangs up the channel between ALICE and BOB. Asterisk plays a short beep tone to CATHY and then bridges the channels for BOB and CATHY.</li>
</ul>
<h2 id="FeatureCodeCallTransfers-Transferfeatureoptions" style="margin: 10px 0 0 0; font-size: 20px; font-weight: normal; line-height: 30px; margin: 40px 0 0 0">Transfer feature options</h2>
<p style="margin: 10px 0 0 0">These options are configured in the "[general]" section of features.conf</p>
<h3 id="FeatureCodeCallTransfers-Generaltransferoptions" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-changed" id="changed-diff-1" style="background-color: #d6f0ff;">General transfer options</span> </h3>
<table class="diff-macro" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/noformat.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>No Format</th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <pre style="margin: 10px 0 0 0; margin-top: 0">;transferdigittimeout =<span class="diff-html-removed" id="removed-diff-4" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">></span> 3 ; Number of seconds to wait between digits when transferring a call
; (default is 3 seconds)</pre> </td>
</tr>
</tbody>
</table>
<h3 id="FeatureCodeCallTransfers-Attendedtransferoptions" style="margin: 10px 0 0 0; font-size: 16px; line-height: 25px; margin: 30px 0 0 0"> <span class="diff-html-changed" id="changed-diff-2" style="background-color: #d6f0ff;">Attended transfer options</span> </h3>
<table class="diff-macro" style="background-color: #f0f0f0;border: 1px solid #dddddd;margin: 10px 1px;padding: 0 2px 2px;width: 100%;; border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<thead>
<tr>
<th class="diff-macro-title" style="background-color: transparent; text-align: left; font-weight: normal;padding: 5px;"><span class="icon macro-placeholder-icon" style="background-color: ;line-height: 20px;"><img src="https://wiki.asterisk.org/wiki/s/en_GB/5639/a252d7f5e75d7a8bf7047b4b2c92f71a56a8f048.48/_/images/icons/macrobrowser/dropdown/noformat.png" style="padding-right: 5px; vertical-align: text-bottom;" /> </span>No Format</th>
</tr>
</thead>
<tbody>
<tr>
<td class="diff-macro-body" style="background-color: #fff;border: 1px solid #dddddd;padding: 10px;; padding: 0px; border-collapse: collapse"> <pre style="margin: 10px 0 0 0; margin-top: 0">;xfersound = beep ; to indicate an attended transfer is complete
;xferfailsound = beeperr ; to indicate a failed transfer
;<span class="diff-html-removed" id="removed-diff-5" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">atxfernoanswertimeout = 15 ; Timeout for answer on attended transfer default is 15 seconds.
;atxferdropcall = no ; If someone does an attended transfer, then hangs up before the transfer
; target answers, then by default, the system will try to call back the
; person that did the transfer. If this is set to "yes", the ringing
; transfer target is immediately transferred to the transferee.
;atxferloopdelay = 10 ; Number of seconds to sleep between retries (if atxferdropcall = no)
;atxfercallbackretries = 2 ; Number of times to attempt to send the call back to the transferer.
; By default, this is 2.
;</span>transferdialattempts = 3 ; Number of times that a transferer may attempt to dial an extension before
; being kicked back to the original call.
;transferretrysound = "beep" ; Sound to play when a transferer fails to dial a valid extension.
;transferinvalidsound = "beeperr" ; Sound to play when a transferer fails to dial a valid extension and is out of retries.
<span class="diff-html-removed" id="removed-diff-6" style="font-size: 100%; background-color: #ffe7e7; text-decoration: line-through;">;atxferabort = *1 ; cancel the attended transfer
;atxfercomplete = *2 ; complete the attended transfer, dropping out of the call
;atxferthreeway = *3 ; complete the attended transfer, but stay in the call. This will turn the call into a multi-party bridge
;atxferswap = *4 ; swap to the other party. Once an attended transfer has begun, this options may be used multiple times</span>
</pre> </td>
</tr>
</tbody>
</table>
</div> </td>
</tr>
</tbody>
</table> </td>
</tr>
</tbody>
</table> </td>
</tr>
<tr>
<td class="email-content-main mobile-expand action-padding last-row-padding" style="padding: 0px; border-collapse: collapse; border-left: 1px solid #ccc; border-right: 1px solid #ccc; border-top: 0; border-bottom: 0; padding: 0 15px 15px 16px; background-color: #fff; padding-bottom: 10px; padding-bottom: 10px">
<table id="actions-pattern" cellspacing="0" cellpadding="0" border="0" width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 1px">
<tbody>
<tr>
<td id="actions-pattern-container" valign="middle" style="padding: 0px; border-collapse: collapse; padding: 15px 0 0 24px; vertical-align: middle">
<table align="left" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td class="actions-pattern-action-icon-container" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 0px; vertical-align: middle"><a href="https://wiki.asterisk.org/wiki/display/AST/Feature+Code+Call+Transfers?src=email" title="View page Icon" style="color: #3b73af; text-decoration: none"><img class="actions-pattern-action-icon-image" height="16" width="16" border="0" title="View page Icon" src="cid:com.atlassian.confluence.plugins.confluence-email-resources%3Aview-page-email-adg-footer-item%3Aicon" alt="View page Icon" style="vertical-align: middle" /></a></td>
<td class="actions-pattern-action-text-container" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 4px; padding-left: 5px; white-space: nowrap"><a href="https://wiki.asterisk.org/wiki/display/AST/Feature+Code+Call+Transfers?src=email" title="View page" style="color: #3b73af; text-decoration: none">View page</a></td>
<td class="actions-pattern-action-bull" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 4px; color: #999; padding: 0 5px">•</td>
</tr>
</tbody>
</table>
<table align="left" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td class="actions-pattern-action-icon-container" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 0px; vertical-align: middle"><a href="https://wiki.asterisk.org/wiki/display/AST/Feature+Code+Call+Transfers?showComments=true&showCommentArea=true&src=email#addcomment" title="Add comment Icon" style="color: #3b73af; text-decoration: none"><img class="actions-pattern-action-icon-image" height="16" width="16" border="0" title="Add comment Icon" src="cid:com.atlassian.confluence.plugins.confluence-email-resources%3Aadd-comment-to-content-email-adg-footer-item%3Aicon" alt="Add comment Icon" style="vertical-align: middle" /></a></td>
<td class="actions-pattern-action-text-container" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 4px; padding-left: 5px; white-space: nowrap"><a href="https://wiki.asterisk.org/wiki/display/AST/Feature+Code+Call+Transfers?showComments=true&showCommentArea=true&src=email#addcomment" title="Add comment" style="color: #3b73af; text-decoration: none">Add comment</a></td>
<td class="actions-pattern-action-bull" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 4px; color: #999; padding: 0 5px">•</td>
</tr>
</tbody>
</table>
<table style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td class="actions-pattern-action-icon-container" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 0px; vertical-align: middle"><a href="https://wiki.asterisk.org/wiki/plugins/likes/like.action?contentId=32375739&src=email" title="Like Icon" style="color: #3b73af; text-decoration: none"><img class="actions-pattern-action-icon-image" height="16" width="16" border="0" title="Like Icon" src="cid:com.atlassian.confluence.plugins.confluence-like%3Aview-email-adg-content-item%3Aicon" alt="Like Icon" style="vertical-align: middle" /></a></td>
<td class="actions-pattern-action-text-container" style="padding: 0px; border-collapse: collapse; font-family: Arial, sans-serif; font-size: 14px; line-height: 20px; mso-line-height-rule: exactly; mso-text-raise: 4px; padding-left: 5px; white-space: nowrap"><a href="https://wiki.asterisk.org/wiki/plugins/likes/like.action?contentId=32375739&src=email" title="Like" style="color: #3b73af; text-decoration: none">Like</a></td>
</tr>
</tbody>
</table> </td>
</tr>
</tbody>
</table> </td>
</tr>
<tr>
<td class="email-content-rounded-bottom mobile-expand" style="padding: 0px; border-collapse: collapse; color: #fff; height: 5px; line-height: 5px; padding: 0 15px 0 16px; background-color: #fff; border-bottom-right-radius: 5px; border-bottom-left-radius: 5px; border-top: 0; border-left: 1px solid #ccc; border-bottom: 1px solid #ccc; border-right: 1px solid #ccc; mso-line-height-rule: exactly"> </td>
</tr>
</tbody>
</table>
<table id="footer-pattern-container" cellspacing="0" cellpadding="0" border="0" width="100%" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333">
<tbody>
<tr>
<td id="footer-pattern-links-container" width="100%" style="padding: 0px; border-collapse: collapse; color: #999; font-size: 12px; line-height: 18px; font-family: Arial, sans-serif; mso-line-height-rule: exactly; mso-text-raise: 2px">
<table align="left" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; font-size: 12px; line-height: 18px; font-family: Arial, sans-serif; mso-line-height-rule: exactly; mso-text-raise: 2px">
<tbody>
<tr>
<td class="footer-pattern-links mobile-resize-text" style="padding: 0px; border-collapse: collapse"><a href="https://wiki.asterisk.org/wiki/users/removespacenotification.action?spaceKey=AST&src=email" title="" style="color: #3b73af; text-decoration: none">Stop watching space</a></td>
<td class="footer-pattern-links-bull" style="padding: 0px; border-collapse: collapse; padding: 0 5px; color: #999">•</td>
</tr>
</tbody>
</table>
<table style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; font-size: 12px; line-height: 18px; font-family: Arial, sans-serif; mso-line-height-rule: exactly; mso-text-raise: 2px">
<tbody>
<tr>
<td class="footer-pattern-links mobile-resize-text" style="padding: 0px; border-collapse: collapse"><a href="https://wiki.asterisk.org/wiki/users/editmyemailsettings.action?src=email" title="" style="color: #3b73af; text-decoration: none">Manage notifications</a></td>
</tr>
</tbody>
</table> </td>
</tr>
<tr>
<td id="footer-pattern-text" class="mobile-resize-text" width="100%" style="padding: 0px; border-collapse: collapse; color: #999; font-size: 12px; line-height: 18px; font-family: Arial, sans-serif; mso-line-height-rule: exactly; mso-text-raise: 2px; display: none">This message was sent by Atlassian Confluence 5.6.6</td>
</tr>
</tbody>
</table>
<table id="sealed-section" border="0" cellpadding="0" cellspacing="0" width="0" style="border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; color: #333; display: none">
<tbody>
<tr>
<td style="padding: 0px; border-collapse: collapse; border: 0; font-size: 0px; line-height: 0; mso-line-height-rule: exactly"></td>
</tr>
</tbody>
</table>
</body>
</html>